Antibody data

Product number
H00004288-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004288-M01, RRID:AB_565902
Product name
MKI67 monoclonal antibody (M01), clone 7B8
Provider product page
Abnova Corporation - H00004288-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant MKI67.
Antigen sequence
RSARQNESSQPKVAEESGGQKSAKVLMQNQKGKGE
AGNSDSMCLRSRKTKSQPAASTLESKSVQRVTRSV
KRCAENPKKAEDNVCVKKIRTRSHRDSEDI
Isotype
IgG
Antibody clone number
7B8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.