HPA040282

TMX2 antibody from Atlas Antibodies
PDIA12, TXNDC14
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA040282
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA040282, RRID:AB_10697715
Product name
Anti-TMX2
Provider product page
Atlas Antibodies - HPA040282
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
YMGPEYIKYFNDKTIDEELERDKRVTWIVEFFANW
SNDCQSFAPIYADLSLKYNCTGLNFGKVDVGRYTD
VSTRYKVSTSP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -